PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01008109001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family TCP
Protein Properties Length: 218aa    MW: 24737.4 Da    PI: 9.719
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01008109001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP93.15.8e-29110177370
                TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssa 70 
                        g+kdrhsk++T +g+RdRR+Rls+++a++++dLqd+LG+ ++sk ++WLl + k++i++l+ ++ ++ 
  GSVIVT01008109001 110 GGKDRHSKVCTVRGLRDRRIRLSVPTAIQLYDLQDRLGLSQPSKVVDWLLDATKHEIDKLPPLQIPQG 177
                        79***********************************************************9944443 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036348.2E-27111174IPR005333Transcription factor, TCP
PROSITE profilePS5136930.021111169IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0030154Biological Processcell differentiation
GO:0045962Biological Processpositive regulation of development, heterochronic
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MSQCSSSLTS YKYNNPALVL FLLFHTLLLF QHSGYLGVGR CLKVSPGFDS LQLNDDHERS  60
KMIPNSRERD FQAKLEDATI EGKFSKAPSS SRQWSAFRNP RIVRVSRSFG GKDRHSKVCT  120
VRGLRDRRIR LSVPTAIQLY DLQDRLGLSQ PSKVVDWLLD ATKHEIDKLP PLQIPQGNLG  180
QFHQSMLVSH ELDQNTIFCK GGVICREVVN WQCYMIS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00008PBMTransfer from 496250Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4337060.0AM433706.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X128180.7, clone ENTAV 115.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003634271.18e-90PREDICTED: transcription factor TCP5
RefseqXP_010663449.18e-90PREDICTED: transcription factor TCP5
TrEMBLB9RLM29e-68B9RLM2_RICCO; Transcription factor, putative
STRINGPOPTR_0015s06980.14e-63(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP18015163
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60970.12e-49TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 5